Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 9 kDa |
Gene Name | apolipoprotein A2 |
Database Link | |
Background | This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. |
Synonyms | Apo-AII; ApoA-II; apoAII |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Bovine: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Mouse: 85%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | PPAR signaling pathway |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.