ANXA2R Rabbit Polyclonal Antibody

SKU
TA334944
Rabbit Polyclonal Anti-ANXA2R Antibody
$585.00
2 Weeks*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ANXA2R antibody: synthetic peptide directed towards the N terminal of human ANXA2R. Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 22 kDa
Gene Name annexin A2 receptor
Database Link
Background ANXA2R may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.
Synonyms AX2R; AXIIR; C5orf39
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ANXA2R Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.