C8orf80 (NUGGC) Rabbit Polyclonal Antibody

SKU TA334896

Rabbit Polyclonal Anti-NUGGC Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUGGC antibody is: synthetic peptide directed towards the C-terminal region of Human NUGGC. Synthetic peptide located within the following region: RSGWKYDSCKKNFLIQEISAILGGLEDHILRRKRRIYESLTASVQSDLKL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 91 kDa
• Gene Name: nuclear GTPase, germinal center associated
• Database Link:
  NP_001010906
  Q68CJ6
• Background: NUGGC plays a role as replication-related GTPase protein in germinal center B-cell.
• Synonyms: C8orf80; HMFN0672; SLIP-GC
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 79%

Reference Data