C1orf187 (DRAXIN) Rabbit Polyclonal Antibody

SKU TA334876

Rabbit Polyclonal Anti-DRAXIN Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DRAXIN antibody is: synthetic peptide directed towards the C-terminal region of Human DRAXIN. Synthetic peptide located within the following region: TLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: dorsal inhibitory axon guidance protein
• Database Link:
  NP_940947
  Q8NBI3
• Background: DRAXIN is a chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. It acts as a chemorepulsive guidance protein for commissural axons during development and is able to inhibit or repel neurite outgrowth from dorsal spinal cord. DRAXIN inhibits the stabilization of cytosolic beta-catenin (CTNNB1) via its interaction with LRP6, thereby acting as an antagonist of Wnt signaling pathway.
• Synonyms: AGPA3119; C1orf187; neucrin; UNQ3119
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 86%; Bovine: 86%

Reference Data

• Protein Families: Secreted Protein, Transmembrane