Allergin 1 (MILR1) Rabbit Polyclonal Antibody

SKU TA334844

Rabbit Polyclonal Anti-MILR1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MILR1 antibody is: synthetic peptide directed towards the C-terminal region of Human MILR1. Synthetic peptide located within the following region: KTRKAMRNNVPRDRGDTAMEVGIYANILEKQAKEESVPEVGSRPCVSTAQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: mast cell immunoglobulin like receptor 1
• Database Link:
  NP_001078892
  Q7Z6M3
• Background: MILR1 is an immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. It negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.
• Synonyms: Allergin-1; C17orf60; MCA-32; MCA32
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane