Fucose mutarotase (FUOM) Rabbit Polyclonal Antibody

SKU TA334836

Rabbit Polyclonal Anti-FUOM Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FUOM antibody is: synthetic peptide directed towards the middle region of Human FUOM. Synthetic peptide located within the following region: LLEAVLKLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 14 kDa
• Gene Name: fucose mutarotase
• Database Link:
  NP_940874
  A2VDF0
• Background: FUOM is involved in the interconversion between alpha- and beta-L-fucoses. L-Fucose (6-deoxy-L-galactose) exists as alpha-L-fucose (29.5%) and beta-L-fucose (70.5%), the beta-form is metabolized through the salvage pathway. GDP-L-fucose formed either by the de novo or salvage pathways is transported into the endoplasmic reticulum, where it serves as a substrate for N- and O-glycosylations by fucosyltransferases. Fucosylated structures expressed on cell surfaces or secreted in biological fluids are believed to play a critical role in cell-cell adhesion and recognition processes.
• Synonyms: C10orf125; FucM; FUCU
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 79%

Reference Data