TAS2R45 Rabbit Polyclonal Antibody

SKU TA334834

Rabbit Polyclonal Anti-TAS2R45 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAS2R45 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R45. Synthetic peptide located within the following region: MLANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: taste 2 receptor member 45
• Database Link:
  NP_795367
• Background: TAS2R45 is a receptor that may play a role in the perception of bitterness and is gustducin-linked. It may play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5
• Synonyms: GPR59; T2R45; ZG24P
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Pig: 83%; Guinea pig: 83%

Reference Data

• Protein Pathways: Taste transduction