PREB Rabbit Polyclonal Antibody

SKU TA334757

Rabbit Polyclonal Anti-PREB Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PREB antibody: synthetic peptide directed towards the N terminal of human PREB. Synthetic peptide located within the following region: RVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: prolactin regulatory element binding
• Database Link:
  NP_037520
  Q9HCU5
• Background: PREB encodes a protein that specifically binds to a Pit1-binding element of the prolactin (PRL) promoter. This protein may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p.
• Synonyms: SEC12
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Guinea pig: 91%; Mouse: 83%; Bovine: 83%

Reference Data

• Protein Families: Transcription Factors, Transmembrane