ZNF179 (RNF112) Rabbit Polyclonal Antibody

SKU TA334756

Rabbit Polyclonal Anti-ZNF179 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF179 antibody: synthetic peptide directed towards the C terminal of human ZNF179. Synthetic peptide located within the following region: GVALLCKGRDQTLEALEAELQATAKAFMDSYTMRFCGHLAAVGGAVGAGL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: ring finger protein 112
• Database Link:
  NP_009079
  Q9ULX5
• Background: ZNF179 encodes a member of the RING finger protein family of transcription factors. The protein is primarily expressed in brain. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
• Synonyms: BFP; ZNF179
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 92%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Transmembrane