BRD8 Rabbit Polyclonal Antibody

SKU TA334747

Rabbit Polyclonal Anti-BRD8 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRD8 antibody: synthetic peptide directed towards the middle region of human BRD8. Synthetic peptide located within the following region: LRSQDLDEELGSTAAGEIVEADVAIGKGDETPLTNVKTEASPESMLSPSH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 135 kDa
• Gene Name: bromodomain containing 8
• Database Link:
  NP_631938
  Q9H0E9
• Background: BRD8 interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator.The protein encoded by this gene interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator. Three alternatively spliced transcript variants that encode distinct isoforms have been identified.
• Synonyms: p120; SMAP; SMAP2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Horse: 92%; Bovine: 92%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors