YL1 (VPS72) Rabbit Polyclonal Antibody

SKU TA334738

Rabbit Polyclonal Anti-TCFL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCFL1 antibody: synthetic peptide directed towards the middle region of human TCFL1. Synthetic peptide located within the following region: TEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: vacuolar protein sorting 72 homolog
• Database Link:
  NP_005988
  Q15906
• Background: TCFL1 encodes the YL-1 protein which is a subunit of the TRRAP/TIP60 HAT complex, and also is a component of a novel mammalian multiprotein complex that includes the SNF2-related helicase SRCAP.
• Synonyms: CFL1; Swc2; TCFL1; YL-1; YL1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors