MKLP1 (KIF23) Rabbit Polyclonal Antibody

SKU TA334709

Rabbit Polyclonal Anti-KIF23 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF23 antibody: synthetic peptide directed towards the N terminal of human KIF23. Synthetic peptide located within the following region: MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 98 kDa
• Gene Name: kinesin family member 23
• Database Link:
  NP_004847
  Q02241
• Background: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
• Synonyms: CHO1; KNSL5; MKLP-1; MKLP1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome