KIF2B Rabbit Polyclonal Antibody

SKU
TA334702
Rabbit Polyclonal Anti-KIF2B Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KIF2B antibody: synthetic peptide directed towards the middle region of human KIF2B. Synthetic peptide located within the following region: CVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 76 kDa
Gene Name kinesin family member 2B
Database Link
Background KIF2B is the plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. KIF2B has microtubule depolymerization activity.
Synonyms FLJ53902
Note Immunogen Sequence Homology: Human: 100%; Dog: 87%; Pig: 87%; Mouse: 87%; Guinea pig: 87%; Rat: 80%; Rabbit: 80%; Horse: 79%
Reference Data
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:KIF2B Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.