KIF3A Rabbit Polyclonal Antibody

SKU TA334695

Rabbit Polyclonal Anti-KIF3A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF3A antibody: synthetic peptide directed towards the C terminal of human KIF3A. Synthetic peptide located within the following region: PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 80 kDa
• Gene Name: kinesin family member 3A
• Database Link:
  NP_008985
  Q9Y496
• Background: KIF3A/B is a kinesin involved in intraflagellar transport and Golgi trafficking.
• Synonyms: FLA10; KLP-20
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome