KIF1A Rabbit Polyclonal Antibody

SKU TA334686

Rabbit Polyclonal Anti-KIF1A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF1A antibody: synthetic peptide directed towards the N terminal of human KIF1A. Synthetic peptide located within the following region: TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 191 kDa
• Gene Name: kinesin family member 1A
• Database Link:
  NP_004312
  Q12756
• Background: KIF1A is the motor for anterograde axonal transport of synaptic vesicle precursors.The protein encoded by this gene is a member of the kinesin family. This protein is highly similar to mouse heavy chain kinesin member 1A protein which is an anterograde motor protein that transports membranous organelles along axonal microtubules. It is thought that this protein may play a critical role in the development of axonal neuropathies resulting from impaired axonal transport. There are multiple polyadenylation sites found in this gene. Sequence Note: X90840.1 is a chimeric sequence. Only the ATSV region was propagated into this RefSeq record. [6/26/03, RefSeq staff]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: ATSV; C2orf20; HSN2C; MRD9; SPG30; UNC104
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome