beta glucuronidase (GUSB) Rabbit Polyclonal Antibody

SKU TA334656

Rabbit Polyclonal Anti-GUSB Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: glucuronidase beta
• Database Link:
  NP_000172
  P08236
• Background: GUSB plays an important role in the degradation of dermatan and keratan sulfates.
• Synonyms: BG; MPS7
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Dog: 92%; Rat: 92%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Drug metabolism - other enzymes, Glycosaminoglycan degradation, Lysosome, Metabolic pathways, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Starch and sucrose metabolism