Galactoside 2 alpha L fucosyltransferase 1 (FUT1) Rabbit Polyclonal Antibody

SKU TA334650

Rabbit Polyclonal Anti-FUT1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FUT1 antibody: synthetic peptide directed towards the middle region of human FUT1. Synthetic peptide located within the following region: EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: fucosyltransferase 1 (H blood group)
• Database Link:
  NP_000139
  P19526
• Background: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
• Synonyms: H; HH; HSC
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; Bovine: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways