SLC25A34 Rabbit Polyclonal Antibody

SKU TA334635

Rabbit Polyclonal Anti-SLC25A34 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC25A34 antibody: synthetic peptide directed towards the middle region of human SLC25A34. Synthetic peptide located within the following region: TDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: solute carrier family 25 member 34
• Database Link:
  NP_997231
  Q6PIV7
• Background: SLC25A34 is a multi-pass membrane protein. It belongs to the mitochondrial carrier family and contains 3 Solcar repeats. The function of the SLC25A34 protein remains unknown. SLC25A34 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]). [supplied by OMIM]
• Synonyms: RP11-169K16.2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 93%; Yeast: 82%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane