OriGene Logo

SLC25A34 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA334635
Rabbit Polyclonal Anti-SLC25A34 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY403973 Transient overexpression lysate of solute carrier family 25, member 34 (SLC25A34) 100 ug
$436.00

View other "SLC25A34 or NM_207348" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SLC25A34 antibody: synthetic peptide directed towards the middle region of human SLC25A34. Synthetic peptide located within the following region: TDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQH
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name solute carrier family 25 member 34
Database Link
Background SLC25A34 is a multi-pass membrane protein. It belongs to the mitochondrial carrier family and contains 3 Solcar repeats. The function of the SLC25A34 protein remains unknown. SLC25A34 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 PubMed 16949250). supplied by OMIM
Synonyms RP11-169K16.2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 93%; Yeast: 82%; Zebrafish: 79%
Reference Data
Protein Categories Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.