SLC9C1 Rabbit Polyclonal Antibody

SKU TA334630

Rabbit Polyclonal Anti-Slc9a10 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Slc9a10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: IQEKAKVVTFDCGNNIFEEGDEPEGIYVIISGMVKLKRSKPHLEMDRVSS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 120 kDa
• Gene Name: solute carrier family 9 member C1
• Database Link:
  NP_898884
  Q4G0N8
• Background: The function of this protein remains unknown.
• Synonyms: NHE; NHE-10; SLC9A10; sperm-NHE
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Mouse: 86%; Rat: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane