FASTKD2 Rabbit Polyclonal Antibody

SKU TA334564

Rabbit Polyclonal Anti-FASTKD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FASTKD2 antibody: synthetic peptide directed towards the middle region of human FASTKD2. Synthetic peptide located within the following region: DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 81 kDa
• Gene Name: FAST kinase domains 2
• Database Link:
  NP_055744
  Q9NYY8
• Background: This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.
• Synonyms: KIAA0971
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 87%

Reference Data