THYN1 Rabbit Polyclonal Antibody

SKU TA334501

Rabbit Polyclonal Anti-THYN1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-THYN1 antibody: synthetic peptide directed towards the middle region of human THYN1. Synthetic peptide located within the following region: NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: thymocyte nuclear protein 1
• Database Link:
  NP_054893
  Q9P016
• Background: THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described.
• Synonyms: HSPC144; MDS012; MY105; THY28; THY28KD
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Zebrafish: 92%; Guinea pig: 92%; Bovine: 86%

Reference Data