REM (REM1) Rabbit Polyclonal Antibody

SKU TA334490

Rabbit Polyclonal Anti-REM1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-REM1 antibody: synthetic peptide directed towards the N terminal of human REM1. Synthetic peptide located within the following region: SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: RRAD and GEM like GTPase 1
• Database Link:
  NP_054731
  O75628
• Background: The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.
• Synonyms: GD:REM; GES
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 92%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome