DNA polymerase mu (POLM) Rabbit Polyclonal Antibody

SKU TA334472

Rabbit Polyclonal Anti-POLM Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POLM antibody: synthetic peptide directed towards the middle region of human POLM. Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: polymerase (DNA) mu
• Database Link:
  NP_037416
  Q9NP87
• Background: POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.
• Synonyms: Pol Mu; Tdt-N
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Guinea pig: 93%; Dog: 92%; Mouse: 86%; Rabbit: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Non-homologous end-joining