C6orf206 (RSPH9) Rabbit Polyclonal Antibody

SKU TA334369

Rabbit Polyclonal Anti-RSPH9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RSPH9 antibody is: synthetic peptide directed towards the middle region of Human RSPH9. Synthetic peptide located within the following region: VKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQID
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: radial spoke head 9 homolog
• Database Link:
  NP_689945
  Q9H1X1
• Background: This gene encodes a protein thought to be a component of the radial spoke head in motile cilia and flagella. Mutations in this gene are associated with primary ciliary dyskinesia 12. Alternative splicing results in multiple transcript variants.
• Synonyms: C6orf206; CILD12; MRPS18AL1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Dog: 86%; Horse: 86%; Rat: 79%; Rabbit: 79%

Reference Data