Qsox2 Rabbit Polyclonal Antibody

SKU TA334358

Rabbit Polyclonal Anti-Qsox2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Qsox2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Qsox2. Synthetic peptide located within the following region: SWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGSVLRARPWLGQMARLSHV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 70 kDa
• Gene Name: quiescin Q6 sulfhydryl oxidase 2
• Database Link:
  NP_705787
  Q3TMX7
• Background: Qsox2 catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. It may contribute to disulfide bond formation in a variety of secreted proteins.
• Synonyms: DKFZp762A2013; QSCN6L1; SOXN
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Bovine: 86%; Dog: 85%; Pig: 79%; Mouse: 79%; Guinea pig: 79%

Reference Data