MTERF2 Rabbit Polyclonal Antibody

SKU TA334331

Rabbit Polyclonal Anti-MTERFD3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MTERFD3 antibody is: synthetic peptide directed towards the N-terminal region of Human MTERFD3. Synthetic peptide located within the following region: TAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQEL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: mitochondrial transcription termination factor 2
• Database Link:
  NP_079474
  Q49AM1
• Background: MTERFD3 binds promoter DNA and regulates mitochondrial transcription. It is required for normal levels of transcription, both for mRNA and tRNA and is required for normal mitochondrial protein synthesis, assembly of respiratory complexes and normal mitochondrial function.
• Synonyms: MTERFD3; mTERFL
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 85%; Guinea pig: 82%

Reference Data