LY6G5C Rabbit Polyclonal Antibody

SKU TA334321

Rabbit Polyclonal Anti-LY6G5C Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LY6G5C antibody is: synthetic peptide directed towards the C-terminal region of Human LY6G5C. Synthetic peptide located within the following region: CITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: lymphocyte antigen 6 complex, locus G5C
• Database Link:
  NP_079538
  Q5SRR4
• Background: LY6G5C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction.
• Synonyms: C6orf20; G5C; LY6G5CA; LY6G5CB; NG33
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Dog: 85%; Rat: 77%; Rabbit: 77%

Reference Data

• Protein Families: Transmembrane