AFM Rabbit Polyclonal Antibody

SKU
TA334276
Rabbit Polyclonal Anti-AFM Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-AFM antibody: synthetic peptide directed towards the C terminal of human AFM. Synthetic peptide located within the following region: HADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCC
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 67 kDa
Gene Name afamin
Database Link
Background AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.
Synonyms ALB2; ALBA; ALF
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Dog: 91%
Reference Data
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:AFM Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.