EPB42 Rabbit Polyclonal Antibody

SKU TA334274

Rabbit Polyclonal Anti-EPB42 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EPB42 antibody: synthetic peptide directed towards the middle region of human EPB42. Synthetic peptide located within the following region: ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 80 kDa
• Gene Name: erythrocyte membrane protein band 4.2
• Database Link:
  NP_000110
  P16452
• Background: Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia.
• Synonyms: PA; SPH5
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Bovine: 85%; Pig: 77%; Guinea pig: 77%; Zebrafish: 75%

Reference Data

• Protein Families: Druggable Genome