FOXQ1 Rabbit Polyclonal Antibody

SKU TA334252

Rabbit Polyclonal Anti-FOXQ1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXQ1 antibody: synthetic peptide directed towards the N terminal of human FOXQ1. Synthetic peptide located within the following region: MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: forkhead box Q1
• Database Link:
  NP_150285
  Q9C009
• Background: FOXQ1 contains 1 fork-head DNA-binding domain. FOXQ1 mediates the interaction of Akt/protein kinase B with TGFb2. Foxq1 regulates differentiation of hair in satin mice.
• Synonyms: HFH1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 85%; Mouse: 85%

Reference Data

• Protein Families: Transcription Factors