Mortality Factor 4 like 2 (MORF4L2) Rabbit Polyclonal Antibody

SKU
TA334235
Rabbit Polyclonal Anti-MORF4L2 Antibody
$525.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MORF4L2 antibody: synthetic peptide directed towards the N terminal of human MORF4L2. Synthetic peptide located within the following region: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKN
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name mortality factor 4 like 2
Database Link
Background MORF4L2 is a member of the mortality factor (MORF) family of putative transcriptional regulators
Synonyms MORFL2; MRGX
Note Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Yeast: 91%; Bovine: 85%; Guinea pig: 85%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:Mortality Factor 4 like 2 (MORF4L2) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.