ZBTB39 Rabbit Polyclonal Antibody

SKU
TA334224
Rabbit Polyclonal Anti-ZBTB39 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZBTB39 antibody: synthetic peptide directed towards the middle region of human ZBTB39. Synthetic peptide located within the following region: CRLCSQSFKSEAAYRYHVSQHKCNSGLDARPGFGLQHPALQKRKLPAEEF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 79 kDa
Gene Name zinc finger and BTB domain containing 39
Database Link
Background ZBTB39 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 BTB (POZ) domain and 8 C2H2-type zinc fingers. ZBTB39 may be involved in transcriptional regulation.
Synonyms ZNF922
Note Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZBTB39 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.