SHOX Rabbit Polyclonal Antibody

SKU
TA334167
Rabbit Polyclonal Anti-SHOX Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SHOX Antibody: synthetic peptide directed towards the N terminal of human SHOX. Synthetic peptide located within the following region: EELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name short stature homeobox
Database Link
Background This gene belongs to the paired homeobox family and is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Defects in this gene are associated with idiopathic growth retardation and in the short stature phenotype of Turner syndrome patients. This gene is highly conserved across species from mammals to fish to flies.This gene belongs to the paired homeobox family and is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Defects in this gene are associated with idiopathic growth retardation and in the short stature phenotype of Turner syndrome patients. This gene is highly conserved across species from mammals to fish to flies. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Synonyms GCFX; PHOG; SHOXY; SS
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Zebrafish: 90%; Rat: 82%; Mouse: 82%; Guinea pig: 82%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:SHOX Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.