SHOX Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SHOX Antibody: synthetic peptide directed towards the N terminal of human SHOX. Synthetic peptide located within the following region: EELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGT |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 32 kDa |
Gene Name | short stature homeobox |
Database Link | |
Background | This gene belongs to the paired homeobox family and is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Defects in this gene are associated with idiopathic growth retardation and in the short stature phenotype of Turner syndrome patients. This gene is highly conserved across species from mammals to fish to flies.This gene belongs to the paired homeobox family and is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Defects in this gene are associated with idiopathic growth retardation and in the short stature phenotype of Turner syndrome patients. This gene is highly conserved across species from mammals to fish to flies. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Synonyms | GCFX; PHOG; SHOXY; SS |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Zebrafish: 90%; Rat: 82%; Mouse: 82%; Guinea pig: 82% |
Reference Data | |
Protein Families | Transcription Factors |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.