SLC10A2 Rabbit Polyclonal Antibody

SKU TA334166

Rabbit Polyclonal Anti-Slc10a2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Slc10a2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: solute carrier family 10 member 2
• Database Link:
  NP_000443
  Q12908
• Background: Slc10a2 plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. It plays a key role in cholesterol metabolism.
• Synonyms: ASBT; IBAT; ISBT; NTCP2; PBAM
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 93%; Pig: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane