SLC7A2 Rabbit Polyclonal Antibody

SKU TA334148

Rabbit Polyclonal Anti-SLC7A2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC7A2 Antibody: synthetic peptide directed towards the middle region of human SLC7A2. Synthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: solute carrier family 7 member 2
• Database Link:
  NP_001008539
  P52569
• Background: SLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.
• Synonyms: ATRC2; CAT2; HCAT2
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane