MEX3A Rabbit Polyclonal Antibody

SKU TA334108

Rabbit Polyclonal Anti-MEX3A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MEX3A Antibody is: synthetic peptide directed towards the N-terminal region of Human MEX3A. Synthetic peptide located within the following region: GEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: mex-3 RNA binding family member A
• Database Link:
  NP_001087194
  A1L020
• Background: MEX3A is a RNA binding protein, may be involved in post-transcriptional regulatory mechanisms.
• Synonyms: MEX-3A; RKHD4
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome