EIF4E1B Rabbit Polyclonal Antibody

SKU TA334103

Rabbit Polyclonal Anti-EIF4E1B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EIF4E1B Antibody is: synthetic peptide directed towards the middle region of Human EIF4E1B. Synthetic peptide located within the following region: CDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: eukaryotic translation initiation factor 4E family member 1B
• Database Link:
  NP_001092878
  A6NMX2
• Background: EIF4E1B recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structure.
• Synonyms: FLJ36951
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Rabbit: 86%; Zebrafish: 85%; Mouse: 79%

Reference Data

• Protein Pathways: Insulin signaling pathway, mTOR signaling pathway