SLC37A4 Rabbit Polyclonal Antibody

SKU TA334059

Rabbit Polyclonal Anti-SLC37A4 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC37A4 Antibody: synthetic peptide directed towards the N terminal of human SLC37A4. Synthetic peptide located within the following region: LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: solute carrier family 37 member 4
• Database Link:
  NP_001458
  O43826
• Background: SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
• Synonyms: G6PT1; G6PT2; G6PT3; GSD1b; GSD1c; GSD1d; PRO0685; TRG-19; TRG19
• Note: Immunogen sequence homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane