Monocarboxylic acid transporter 1 (SLC16A1) Rabbit Polyclonal Antibody

SKU TA334044

Rabbit Polyclonal Anti-SLC16A1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC16A1 Antibody: synthetic peptide directed towards the middle region of human SLC16A1. Synthetic peptide located within the following region: KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTIN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: solute carrier family 16 member 1
• Database Link:
  NP_003042
  P53985
• Background: SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes Import and export of these substrates by tissues such as erythrocytes, muscle, intestine, and kidney are ascribed largely to the action of a proton-coupled MCT.
• Synonyms: HHF7; MCT; MCT1; MCT1D
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane