SLC34A1 Rabbit Polyclonal Antibody

SKU TA334043

Rabbit Polyclonal Anti-Slc34a1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Slc34a1 Antibody is: synthetic peptide directed towards the N-terminal region of RAT Slc34a1. Synthetic peptide located within the following region: YVPSPQVLHRIPGTTTYAISSLSPVALTEHSCPYGEVLECHDPLPAKLAQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: solute carrier family 34 member 1
• Database Link:
  NP_003043
  Q06495
• Background: The function of this protein remains unknown.
• Synonyms: FRTS2; NAPI-3; NPHLOP1; NPT2; NPTIIa; SLC11; SLC17A2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Horse: 92%

Reference Data

• Protein Families: Transmembrane