T Rabbit Polyclonal Antibody

SKU TA334030

Rabbit Polyclonal Anti-T Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-T Antibody: synthetic peptide directed towards the N terminal of human T. Synthetic peptide located within the following region: SSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESEL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: T brachyury transcription factor
• Database Link:
  NP_003172
  O15178
• Background: The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells.
• Synonyms: SAVA; TFT
• Note: Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Dog: 92%; Rabbit: 92%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors