SLC7A7 Rabbit Polyclonal Antibody

SKU TA333985

Rabbit Polyclonal Anti-SLC7A7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC7A7 Antibody: synthetic peptide directed towards the middle region of human SLC7A7. Synthetic peptide located within the following region: WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: solute carrier family 7 member 7
• Database Link:
  NP_003973
  Q9UM01
• Background: The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.
• Synonyms: LAT3; LPI; MOP-2; y+LAT-1; Y+LAT1
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Dog: 86%; Rat: 79%; Mouse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane