SLC22A13 Rabbit Polyclonal Antibody

SKU TA333973

Rabbit Polyclonal Anti-SLC22A13 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC22A13 Antibody: synthetic peptide directed towards the N terminal of human SLC22A13. Synthetic peptide located within the following region: FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 61 kDa
• Gene Name: solute carrier family 22 member 13
• Database Link:
  NP_004247
  Q9Y226
• Background: SLC22A13 is a member of the organic-cation transporter family. SLC22A13 is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-28 DA629093.1 1-28 29-485 AB010438.1 1-457 486-1375 BC035973.1 486-1375 1376-1554 AB010438.1 1348-1526 1555-2555 BC035973.1 1533-2533
• Synonyms: OAT10; OCTL1; OCTL3; ORCTL-3; ORCTL3
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 79%

Reference Data

• Protein Families: Transmembrane