UCP4 (SLC25A27) Rabbit Polyclonal Antibody

SKU TA333972

Rabbit Polyclonal Anti-Slc25a27 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Slc25a27 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EDNISTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: solute carrier family 25 member 27
• Database Link:
  NP_004268
  O95847
• Background: The function remains unknown.
• Synonyms: UCP4
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome