CLEC3A Rabbit Polyclonal Antibody

SKU TA333932

Rabbit Polyclonal Anti-CLEC3A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CLEC3A Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC3A. Synthetic peptide located within the following region: GKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 22 kDa
• Gene Name: C-type lectin domain family 3 member A
• Database Link:
  NP_005743
  O75596
• Background: CLEC3A promotes cell adhesion to laminin-332 and fibronectin.
• Synonyms: CLECSF1
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%; Zebrafish: 79%

Reference Data