ZNF24 Rabbit Polyclonal Antibody

SKU
TA333902
Rabbit Polyclonal Anti-ZNF24 Antibody
$585.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF24 Antibody: synthetic peptide directed towards the middle region of human ZNF24. Synthetic peptide located within the following region: CDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFKYGETCFPKGR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 42 kDa
Gene Name zinc finger protein 24
Database Link
Background ZNF24 is a new candidate transcription factor.
Synonyms KOX17; RSG-A; Zfp191; ZNF191; ZSCAN3
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF24 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.