ZBTB25 Rabbit Polyclonal Antibody

SKU TA333901

Rabbit Polyclonal Anti-ZBTB25 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZBTB25 Antibody: synthetic peptide directed towards the middle region of human ZBTB25. Synthetic peptide located within the following region: ADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: zinc finger and BTB domain containing 25
• Database Link:
  NP_008908
  P24278
• Background: ZBTB25 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB25 may be involved in transcriptional regulation.
• Synonyms: C14orf51; KUP; ZNF46
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 92%; Mouse: 92%; Guinea pig: 85%

Reference Data

• Protein Families: Transcription Factors