GLUT8 (SLC2A8) Rabbit Polyclonal Antibody

SKU TA333867

Rabbit Polyclonal Anti-SLC2A8 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC2A8 Antibody: synthetic peptide directed towards the middle region of human SLC2A8. Synthetic peptide located within the following region: VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: solute carrier family 2 member 8
• Database Link:
  NP_055395
  Q9NY64
• Background: SLC2A8 is the insulin-regulated facilitative glucose transporter.SLC2A8 binds cytochalasin B in a glucose-inhibitable manner.SLC2A8 seems to be a dual-specific sugar transporter as it is inhibitable by fructose.
• Synonyms: GLUT8; GLUTX1
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%

Reference Data

• Protein Families: Transmembrane