STK38L Rabbit Polyclonal Antibody

SKU TA333856

Rabbit Polyclonal Anti-STK38L Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-STK38L Antibody: synthetic peptide directed towards the middle region of human STK38L. Synthetic peptide located within the following region: PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: serine/threonine kinase 38 like
• Database Link:
  NP_055815
  Q9Y2H1
• Background: STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.
• Synonyms: NDR2
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase